Recombinant human VEGF Receptor 3 protein (Fc Chimera) (ab54261)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWTWPGAQEVLTTGGKD SEDTRVVHDCEGTEARPYCKVLLLAQTHANNTGSYHCYYKYIKARIEGTT AASTYVFVRDFKHPFINKPDTLLVNRKDSMWVPCLVSIPGLNITLRSQSS ALHPDGQEVLWDDRRGMRVPTQLLRDALYLQCETTWGDQNFLSNLFVVHI TGNELYDIQLYPKKSMELLVGEKLVLNCTVWAEFDSGVTFDWDYPGKQAE RAKWVPERRSQQTHTELSSILTIHNVSQNDLGPYVCEANNGIQRFRESTE VIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLAAYPPPEFQWYKDRKA VTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNVPPHI HEKEASSPSIYSRHSRQTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSL RRRQQRDGMPQCRDWKEVTTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQ DANVSAMYKCVVVNKVGQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSV RLSCRADNYTYEHLRWYRLNLSTLHDAQGNPLLLDCKNVHLFATPLEANL EEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRSQDKHCHKKYLSVQA LEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEKESGI DLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSM ESDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Molecular weight
      130 kDa
    • Amino acids
      25 to 775
    • Additional sequence information
      Fused with Fc region of human IgG1. The soluble receptor protein consists of all 7 extracellular domains.

Specifications

Our Abpromise guarantee covers the use of ab54261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to bind recombinant rat VEGF C in a functional solid phase binding assay. Immobilised recombinant human sVEGFR 3/Fc at 5 µg/ml can bind recombinant rat VEGF-C in a linear range of 8-500 ng/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 90 % SDS-PAGE.
    Purity assessed by SDS page followed by Silver stain.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in PBS or medium to a concentration not lower than 100 µg/ml.

General Info

  • Alternative names
    • EC 2.7.10.1
    • flt 4
    • FLT-4
    • FLT4
    • FLT41
    • Fms related tyrosine kinase 4
    • Fms-like tyrosine kinase 4
    • LMPH1A
    • PCL
    • Soluble VEGFR3 variant 1
    • Soluble VEGFR3 variant 2
    • Soluble VEGFR3 variant 3
    • Tyrosine protein kinase receptor FLT4
    • Tyrosine-protein kinase receptor FLT4
    • Vascular endothelial growth factor receptor 3
    • Vascular endothelial growth factor receptor 3 precursor
    • VEGF R3
    • VEGFR 3
    • VEGFR-3
    • VEGFR3
    • VGFR3_HUMAN
    see all
  • Function
    Receptor for VEGFC. Has a tyrosine-protein kinase activity.
  • Tissue specificity
    Placenta, lung, heart, and kidney, does not seem to be expressed in pancreas and brain.
  • Involvement in disease
    Defects in FLT4 are the cause of lymphedema hereditary type 1A (LMPH1A) [MIM:153100]; also known as Nonne-Milroy lymphedema or Milroy disease. Hereditary lymphedema is a chronic disabling condition which results in swelling of the extremities due to altered lymphatic flow. Patients with lymphedema suffer from recurrent local infections and physical impairment.
    Note=Defects in FLT4 are found in juvenile hemangioma. Juvenile hemangiomas are the most common tumors of infancy, occurring as many as 10% of all births. These benign vascular lesions enlarge rapidly during the first year of life by hyperplasia of endothelial cells and attendant pericytes, and then spontaneously involute over a period of years, leaving loose fibrofatty tissue.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab54261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab54261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up