Recombinant human VEGF Receptor 3 protein (Fc Chimera) (ab54261)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWTWPGAQEVLTTGGKD SEDTRVVHDCEGTEARPYCKVLLLAQTHANNTGSYHCYYKYIKARIEGTT AASTYVFVRDFKHPFINKPDTLLVNRKDSMWVPCLVSIPGLNITLRSQSS ALHPDGQEVLWDDRRGMRVPTQLLRDALYLQCETTWGDQNFLSNLFVVHI TGNELYDIQLYPKKSMELLVGEKLVLNCTVWAEFDSGVTFDWDYPGKQAE RAKWVPERRSQQTHTELSSILTIHNVSQNDLGPYVCEANNGIQRFRESTE VIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLAAYPPPEFQWYKDRKA VTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNVPPHI HEKEASSPSIYSRHSRQTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSL RRRQQRDGMPQCRDWKEVTTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQ DANVSAMYKCVVVNKVGQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSV RLSCRADNYTYEHLRWYRLNLSTLHDAQGNPLLLDCKNVHLFATPLEANL EEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRSQDKHCHKKYLSVQA LEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEKESGI DLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSM ESDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Molecular weight
      130 kDa
    • Amino acids
      25 to 775
    • Additional sequence information
      Fused with Fc region of human IgG1. The soluble receptor protein consists of all 7 extracellular domains.

Specifications

Our Abpromise guarantee covers the use of ab54261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to bind recombinant rat VEGF C in a functional solid phase binding assay. Immobilised recombinant human sVEGFR 3/Fc at 5 µg/ml can bind recombinant rat VEGF-C in a linear range of 8-500 ng/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 90 % SDS-PAGE.
    Purity assessed by SDS page followed by Silver stain.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in PBS or medium to a concentration not lower than 100 µg/ml.

General Info

  • Alternative names
    • EC 2.7.10.1
    • flt 4
    • FLT-4
    • FLT4
    • FLT41
    • Fms related tyrosine kinase 4
    • Fms-like tyrosine kinase 4
    • LMPH1A
    • PCL
    • Soluble VEGFR3 variant 1
    • Soluble VEGFR3 variant 2
    • Soluble VEGFR3 variant 3
    • Tyrosine protein kinase receptor FLT4
    • Tyrosine-protein kinase receptor FLT4
    • Vascular endothelial growth factor receptor 3
    • Vascular endothelial growth factor receptor 3 precursor
    • VEGF R3
    • VEGFR 3
    • VEGFR-3
    • VEGFR3
    • VGFR3_HUMAN
    see all
  • Function
    Receptor for VEGFC. Has a tyrosine-protein kinase activity.
  • Tissue specificity
    Placenta, lung, heart, and kidney, does not seem to be expressed in pancreas and brain.
  • Involvement in disease
    Defects in FLT4 are the cause of lymphedema hereditary type 1A (LMPH1A) [MIM:153100]; also known as Nonne-Milroy lymphedema or Milroy disease. Hereditary lymphedema is a chronic disabling condition which results in swelling of the extremities due to altered lymphatic flow. Patients with lymphedema suffer from recurrent local infections and physical impairment.
    Note=Defects in FLT4 are found in juvenile hemangioma. Juvenile hemangiomas are the most common tumors of infancy, occurring as many as 10% of all births. These benign vascular lesions enlarge rapidly during the first year of life by hyperplasia of endothelial cells and attendant pericytes, and then spontaneously involute over a period of years, leaving loose fibrofatty tissue.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References for Recombinant human VEGF Receptor 3 protein (Fc Chimera) (ab54261)

ab54261 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab54261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up