Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoreticalSequence: FESGLDLSDAEPDAGEATAYASKDLEEQ LRSVSSVDELMTVLYPEYW KMYKCQLRKGGWQHNREQANLNSRTEETI KFAAAHYNTEILKSIDNE WRKTQCMPREVCIDVGKEFGVATNTFFKPP CVSVYRCGGCCNSEGLQ CMNTSTSYLSKTLFEITVPLSQGPKPVTISF ANHTSCRCMSKLDVYR QVHSIIRR Disulfide bonded to: SLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDS TD GFHDICGPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCK N KLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQK CLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKR PQMS Note: N-terminal sequences confirmed by Edman sequencing.

Specifications

Our Abpromise guarantee covers the use of ab83573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • Flt 4L
    • Flt4 ligand
    • FLT4 ligand DHM
    • Flt4-L
    • Flt4L
    • Vascular endothelial growth factor C
    • Vascular endothelial growth factor related protein
    • Vascular endothelial growth factor-related protein
    • VEGF C
    • VEGF-C
    • Vegfc
    • VEGFC_HUMAN
    • VRP
    see all
  • FunctionGrowth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.
  • Tissue specificitySpleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte.
  • Sequence similaritiesBelongs to the PDGF/VEGF growth factor family.
  • Post-translational
    modifications
    Undergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3, but only the fully processed form could activate VEGFR-2. VEGF-C first form an antiparallel homodimer linked by disulfide bonds. Before secretion, a cleavage occurs between Arg-227 and Ser-228 producing an heterotetramer. The next extracellular step of the processing removes the N-terminal propeptide. Finally the mature VEGF-C is composed mostly of two VEGF homology domains (VHDs) bound by non-covalent interactions.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human VEGFC protein images

  • The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification. The triangle indicates theoretical pI and MW of the protein.
  • Anti-VEGFC antibody (ab83905) at 1 µg/ml + Recombinant Human VEGFC protein (ab83573) at 0.1 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Predicted band size : 46 kDa


    Exposure time : 4 minutes
  • Lane 1 – MW markers; Lane 2 – ab83573 ; Lane 3 – ab83573 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83573 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 µg of protein was loaded per lane.
    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A possible further drop in MW after treatment with the glycosidase cocktail indicates the possible presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
  • 2D SDS-PAGE: A sample of VEGFC without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Approximately 40 µg of protein was loaded. Spot train indicates presence of multiple isoforms of VEGFC. Spots within the spot train were cut from the gel and identified as VEGFC by protein mass fingerprinting.

References for Recombinant Human VEGFC protein (ab83573)

ab83573 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"