Overview

  • Product name
    Recombinant Human VENTX protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQ TSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTM EQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQM QDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPG SFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCA MPQTGDAF
    • Amino acids
      1 to 258
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hemopoietic progenitor homeobox protein VENTX2
    • Homeobox protein VENTX
    • HPX42B
    • MGC119910
    • MGC119911
    • NA88A
    • VENT homeobox homolog
    • VENT like homeobox 2
    • VENT like homeobox protein 2
    • VENT-like homeobox protein 2
    • VENTX
    • VENTX_HUMAN
    • VENTX2
    see all
  • Function
    May be involved in ventralization.
  • Tissue specificity
    Expressed in bone marrow of patients recovering from chemotherapy. Also expressed in an erythroleukemia cell line.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162133 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up