Recombinant Human Vesicular Acetylcholine Transporter protein (ab152690)

Overview

  • Product name
    Recombinant Human Vesicular Acetylcholine Transporter protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDECEDDY NYYYTRS
    • Molecular weight
      32 kDa including tags
    • Amino acids
      476 to 532

Specifications

Our Abpromise guarantee covers the use of ab152690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Protein corresponds to natural variant rs8187730 with A-E substiution at position 520.
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
    Best use within three months from the date of receipt of this protein.Protein corresponds to natural variant rs8187730 with A-E substiution at position 520.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AChR
    • MGC12716
    • rVAT
    • Slc18a3
    • Solute carrier family 18 (vesicular acetylcholine) member 3
    • Solute carrier family 18 (vesicular monoamine) member 3
    • Solute carrier family 18 member 3
    • VAChT
    • VACHT_HUMAN
    • Vesicular acetylcholine transporter
    see all
  • Function
    Involved in acetylcholine transport into synaptic vesicles.
  • Tissue specificity
    Peripheral and central cholinergic nervous systems.
  • Sequence similarities
    Belongs to the major facilitator superfamily. Vesicular transporter family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152690 stained with Coomassie Blue.

References

ab152690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up