Overview

  • Product name
    Recombinant Human VG5Q protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASEAPSPPRSPPPPTSPEPELAQLRRKVEKLERELRSCKRQVREIEKLL HHTERLYQNAESNNQELRTQVRGPPQPRAPSSPGEAFEARDSLGRGPWQG LRTTVEYLK
    • Amino acids
      1 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGGF 1
    • Aggf1
    • AGGF1_HUMAN
    • Angiogenic factor VG5Q
    • Angiogenic factor with G patch and FHA domains 1
    • G patch domain containing protein 7
    • G patch domain-containing protein 7
    • GPATC 7
    • GPATC7
    • GPATCH 7
    • GPATCH7
    • HSU84971
    • HUS84971
    • hVG5Q
    • Vasculogenesis gene on 5q
    • Vasculogenesis gene on 5q protein
    • VG5Q
    see all
  • Function
    Promotes angiogenesis and the proliferation of endothelial cells. Able to bind to endothelial cells and promote cell proliferation, suggesting that it may act in an autocrine fashion.
  • Tissue specificity
    Widely expressed. Expressed in endothelial cells, vascular smooth muscle cells and osteoblasts. Expressed in umbilical vein endothelial cells and microvascular endothelial cells.
  • Involvement in disease
    Defects in AGGF1 are a cause of Klippel-Trenaunay syndrome (KTS) [MIM:149000]. KTS is a congenital disease characterized by malformations of capillary (98% of KTS patients), venous (72%) and lymphatic (11%) vessels, and bony and soft tissue hypertrophy that leads to large cutaneous hemangiomata with hypertrophy of the related bones and soft tissues.
  • Sequence similarities
    Contains 1 FHA domain.
    Contains 1 G-patch domain.
  • Cellular localization
    Cytoplasm. Secreted. Cytoplasmic in microvascular endothelial cells. Upon angiogenesis, when endothelial cell tube formation is initiated, it is secreted.
  • Information by UniProt

Images

  • ab162962 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up