Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEW YKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTI DFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYK MVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV RLLQCDPSSASQF
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 193
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99299 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • BDR1
    • Calcium binding protein BDR1
    • Calcium-binding protein BDR-1
    • hippocalcin like 1
    • Hippocalcin-like protein 1
    • HLP2
    • HPCAL1
    • HPCAL1 protein
    • HPCL1_HUMAN
    • REM-1
    • VILIP-3
    • Visinin like protein 3
    • Visinin-like protein 3
    see all
  • Function
    May be involved in the calcium-dependent regulation of rhodopsin phosphorylation.
  • Sequence similarities
    Belongs to the recoverin family.
    Contains 4 EF-hand domains.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99299 (3µg).

References

ab99299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up