Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP37235
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEW YKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTI DFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYK MVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV RLLQCDPSSASQF
    • Molecular weight24 kDa including tags
    • Amino acids1 to 193
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab99299 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • BDR1
    • Calcium binding protein BDR1
    • Calcium-binding protein BDR-1
    • hippocalcin like 1
    • Hippocalcin-like protein 1
    • HLP2
    • HPCAL1
    • HPCAL1 protein
    • HPCL1_HUMAN
    • REM-1
    • VILIP-3
    • Visinin like protein 3
    • Visinin-like protein 3
    see all
  • FunctionMay be involved in the calcium-dependent regulation of rhodopsin phosphorylation.
  • Sequence similaritiesBelongs to the recoverin family.
    Contains 4 EF-hand domains.
  • Information by UniProt

Recombinant Human VILIP3 protein images

  • 15% SDS-PAGE showing ab99299 (3µg).

References for Recombinant Human VILIP3 protein (ab99299)

ab99299 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"