Recombinant Human Vinexin protein (ab160858)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADGGSPFLGRRDFVYPSSTRDPSASNGGGSPARREEKKRKAARLKFDFQ AQSPKELTLQKGDIVYIHKEVDKNWLEGEHHGRLGIFPANYVEVLPADEI PKPIKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEHICLIRKVNENWY EGRITGTGRQGIFPASYVQVSREPRLRLCDDGPQLPTSPRLTAAARSARH PSSPSALRSPADPIDLGGQTSPRRTGFSFPTQEPRPQTQNLGTPGPALSH SRGPSHPLDLGTSSPNTSQIHWTPYRAMYQYRPQNEDELELREGDRVDVM QQCDDGWFVGVSRRTQKFGTFPGNYVAPV
    • Amino acids
      1 to 329
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • SCAM 1
    • SCAM1
    • SH3 containing adapter molecule 1
    • SH3 domain containing adapter molecule 1
    • SH3D4
    • Sorbin and SH3 domain containing 3
    • Sorbin and SH3 domain containing protein 3
    • Sorbs3
    • Vinexin
    • Vinexin alpha
    • Vinexin beta (SH3 containing adaptor molecule 1)
    see all
  • Relevance
    Vinexin is a focal adhesion protein with a sorbin homology (SoHo) domain as well as 3 SH3 domains. It exists as at least three splice variants - alpha, beta and gamma. It is thought to play a key role in cell adhesion, cell spreading and migration and cytoskeletal organisation. It has also been implicated signaling due to its interaction with the extracellular signal-regulated kinase ERK. Binds to vinculin at sites of cell-cell contact.
  • Cellular localization
    Localized at cell-extracellular matrix junctions. Both isoforms were localized at focal adhesion and cell-cell adhesion sites, vinexin beta was also found in the nucleus.

Images

  • ab160858 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up