Overview

  • Product nameRecombinant Human VIP protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP01282
    • SpeciesHuman
    • SequenceMDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPD QVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAK KYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSIL NGKRSSEGESPDFPEELEK
    • Molecular weight45 kDa including tags
    • Amino acids1 to 169

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesab112371 is best used within three months from the date of receipt.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Peptide histidine methioninamide 27
    • Peptide histidine valine 42
    • PHM27
    • PHV42
    • Prepro VIP
    • Vasoactive intestinal peptide
    • Vasoactive intestinal polypeptide
    • VIP
    • VIP peptides
    • VIP peptides precursor
    • VIP_HUMAN
    see all
  • FunctionVIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.
    PHM and PHV also cause vasodilation.
  • Sequence similaritiesBelongs to the glucagon family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human VIP protein images

  • ab112371 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human VIP protein (ab112371)

ab112371 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"