Recombinant human Visfatin protein (ab179498)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVV TKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVI PRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKY LLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLA LIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVS VVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVL EILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSI ENIAFGSGGGLLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVADPNKRS KKGRLSLHRTPAGNFVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDE IRKNAQLNIELEAAHH
    • Molecular weight
      53 kDa
    • Amino acids
      27 to 491

Specifications

Our Abpromise guarantee covers the use of ab179498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity is determined by its ability to induce IL-6, IL-1 beta and TNF alpha production from Human PBMCs at 100 ng/mL.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    <=1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.
    Determined by Reducing and Non-reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with 20 mM HCl at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions. Wait several minutes for full reconstitution and solubility.

General Info

  • Alternative names
    • 1110035O14Rik
    • AI314458
    • AI480535
    • DKFZP666B131
    • EC 2.4.2.12
    • MGC117256
    • NAmPRTase
    • Nampt
    • NAMPT_HUMAN
    • Nicotinamide phosphoribosyltransferase
    • PBEF
    • PBEF 1
    • PBEF1
    • Pre B cell colony enhancing factor
    • Pre B cell colony enhancing factor 1
    • Pre B cell enhancing factor
    • Pre-B cell-enhancing factor
    • Pre-B-cell colony-enhancing factor 1
    • VF
    • Visfatin
    see all
  • Function
    Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD. It is the rate limiting component in the mammalian NAD biosynthesis pathway.
  • Tissue specificity
    Expressed in large amounts in bone marrow, liver tissue, and muscle. Also present in heart, placenta, lung, and kidney tissues.
  • Pathway
    Cofactor biosynthesis; NAD(+) biosynthesis; nicotinamide D-ribonucleotide from 5-phospho-alpha-D-ribose 1-diphosphate and nicotinamide: step 1/1.
  • Sequence similarities
    Belongs to the NAPRTase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab179498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up