Recombinant human VLDL Receptor protein (ab155621)

Overview

  • Product name
    Recombinant human VLDL Receptor protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDF VCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQC IPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQD DCSDGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLE QCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRT CRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCR SGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIG YECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQM DLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDAD IAAQKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTI YWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGE PAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSV DLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSE LATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCLPAPQIND HSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEISATSGLVP GGINVTTAVSEVSVPPKGTS
    • Molecular weight
      86 kDa including tags
    • Amino acids
      28 to 797
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its binding ability in a functional ELISA. When Recombinant Human Apolipoprotein E3 is immobilized at 1 µg/ml (100 µl/well), the concentration of Recombinant Human VLDLR that produces 50% of the optimal binding response is found to be approximately 0.03 - 0.15 µg/ml.
  • Applications

    Functional Studies

    ELISA

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute ab155621 in sterile PBS to a final concentration of 50 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. Avoid vigorous shaking or vortexing.

General Info

  • Alternative names
    • FLJ35024
    • Very low density lipoprotein receptor
    • Very low-density lipoprotein receptor
    • VLDL R
    • VLDL receptor
    • VLDL-R
    • VLDLR
    • VLDLR_HUMAN
    • VLDLRCH
    see all
  • Function
    Binds VLDL and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. Binding to Reelin induces tyrosine phosphorylation of Dab1 and modulation of Tau phosphorylation.
  • Tissue specificity
    Abundant in heart and skeletal muscle; also ovary and kidney; not in liver.
  • Involvement in disease
    Defects in VLDLR are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 1 (CMARQ1) [MIM:224050]; also known as dysequilibrium syndrome (DES) or non-progressive cerebellar disorder with mental retardation. CMARQ1 is a congenital, non-progressive cerebellar ataxia associated with disturbed equilibrium, delayed ambulation, mental retardation and cerebellar hypoplasia. Additional features include short stature, strabismus, pes planus and, rarely, seizures.
  • Sequence similarities
    Contains 3 EGF-like domains.
    Contains 8 LDL-receptor class A domains.
    Contains 6 LDL-receptor class B repeats.
  • Post-translational
    modifications
    Ubiquitinated at Lys-839 by MYLIP leading to degradation.
  • Cellular localization
    Membrane. Membrane > clathrin-coated pit.
  • Information by UniProt

Images

  • Purity of ab155621 determined by SDS-PAGE under reduced conditions and stained overnight with Coomassie Blue.

References

ab155621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up