Overview

  • Product nameRecombinant Human VMAT1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9BRE4
    • SpeciesHuman
    • SequenceMLRPILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLY DMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGI AWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEETTRVGVLFASKAVMQ LLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQ GIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVM YEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDP YILVAAGLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMLVVGTSLLC VPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAI ADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRSPP AKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
    • Molecular weight80 kDa including tags
    • Amino acids1 to 494

Specifications

Our Abpromise guarantee covers the use of ab114731 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4832416I10Rik
    • Adrenal chromaffin granule amine transporter; CGAT
    • CGAT
    • Chromaffin granule amine transporter
    • MGC28683
    • MGC37299
    • SLC18A1
    • Solute carrier family 18 (vesicular monoamine), member 1
    • Solute carrier family 18 member 1
    • VAT 1
    • VAT1
    • Vesicular amine transporter 1
    • VMAT 1
    • VMAT1_HUMAN
    see all
  • FunctionInvolved in the vesicular transport of biogenic amines.
  • Sequence similaritiesBelongs to the major facilitator superfamily. Vesicular transporter family.
  • Cellular localizationCytoplasmic vesicle membrane.
  • Information by UniProt

Recombinant Human VMAT1 protein images

  • 12.5% SDS-PAGE showing ab114731 at approximately 80.34kDa.
    Stained with Coomassie Blue.

References for Recombinant Human VMAT1 protein (ab114731)

ab114731 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114731.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"