Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ05940
    • SpeciesHuman
    • SequenceHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTA TQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGL
    • Molecular weight37 kDa including tags
    • Amino acids53 to 151
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110037L13Rik
    • 9330105E13
    • MGC120477
    • MGC120478
    • MGC26538
    • MGC90556
    • MNAT
    • Monoamine neurotransmitter transporter
    • Monoamine transporter
    • OTTHUMP00000020576
    • SLC18A2
    • Solute carrier family 18 (vesicular monoamine) member 2
    • Solute carrier family 18 member 2
    • SVAT
    • SVMT
    • Synaptic vesicle amine transporter brain
    • Synaptic vesicle monoamine transporter brain
    • Synaptic vesicular amine transporter
    • VAT 2
    • VAT2
    • Vesicle monoamine transporter type 2
    • Vesicle monoamine/H+ antiporter
    • Vesicular amine transporter 2
    • Vesicular monoamine transporter 2
    • VMAT 2
    • VMAT2
    • VMAT2_HUMAN
    see all
  • FunctionInvolved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
  • Sequence similaritiesBelongs to the major facilitator superfamily. Vesicular transporter family.
  • Cellular localizationCytoplasmic vesicle membrane.
  • Information by UniProt

Recombinant Human VMAT2 protein images

  • ab112353 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human VMAT2 protein (ab112353)

ab112353 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"