Overview

  • Product name
    Recombinant Human VMO1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPG DDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPLWCRGGAYLVAFS LRVEAPTTLGDNTAANNVRFRCSDGEELQGPGLSWGDFGDWSDHCPKGAC GLQTKIQGPRGLGDDTALNDARLFCCRSVDHHHHHH
    • Molecular weight
      20 kDa including tags
    • Amino acids
      25 to 202
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
    Lyophilized from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.015% EDTA, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • ERGA6350
    • Gm741
    • PRO21055
    • Vitelline membrane outer layer 1
    • Vitelline membrane outer layer protein 1 homolog
    • VMO1
    • VMO1_HUMAN
    see all
  • Sequence similarities
    Belongs to the VMO1 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis showing staining of ab153791.
    Predicted MW 20 kDa.

References

ab153791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up