Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLLLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKL TGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQI
    • Amino acids
      298 to 397
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160240 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HDLCQ8
    • High density lipoprotein cholesterol level quantitative trait locus 8, included
    • Pantetheinase
    • Pantetheine hydrolase
    • Tiff66
    • V-1
    • Vanin 1
    • Vanin-1
    • Vannin 1
    • Vascular non inflammatory molecule 1
    • Vascular non-inflammatory molecule 1
    • VNN 1
    • VNN1
    • VNN1_HUMAN
    see all
  • Function
    Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.
  • Tissue specificity
    Widely expressed with higher expression in spleen, kidney and blood. Overexpressed in lesional psoriatic skin.
  • Sequence similarities
    Belongs to the CN hydrolase family. BTD/VNN subfamily.
    Contains 1 CN hydrolase domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab160240 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160240 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160240.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up