Overview

  • Product name
    Recombinant Human VP16 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      STAPPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGFTPH DSAPYGALDMADFEFEQMFTDALGIDEYGG
    • Amino acids
      411 to 490

Specifications

Our Abpromise guarantee covers the use of ab81832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    Isolated from an E. coli strain that carries the coding sequence of the fused protein under the control of a T7 promoter.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Potassium chloride, 1mM DTT, 0.2mM EDTA, pH 8

General Info

  • Alternative names
    • Alpha TIF
    • Alpha trans inducing protein
    • ICP25
    • UL48
    • Vmw65
    • VP16 protein
    see all
  • Relevance
    Herpes virus VP16 activates expression of immediate early genes in virally-infected cells. As most other eukaryotic transcriptional activator proteins, VP16 has a modular domain structure: it’s N-terminus is involved in DNA-protein interactions, while it’s C-terminal 79 amino acids have proven to be an especially potent transactivation domain. VP16 has been shown to bind to TBP, TFIIB, and replication factor A

References

ab81832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up