Recombinant Human VPREB3 protein (ab162239)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRS EEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
    • Amino acids
      24 to 123
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • N27C7 2
    • N27C7-2
    • Pre B lymphocyte protein 3
    • Pre-B lymphocyte protein 3
    • PRO619
    • Protein VPreB3
    • UNQ355
    • VPRE3_HUMAN
    • VPREB3
    • VpreB3 protein
    see all
  • Function
    Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells.
  • Tissue specificity
    Expressed in B-cell precursors. Expressed in fetal liver, bone marrow, spleen and lymph node.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily.
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Information by UniProt

Images

  • ab162239 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up