Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPG EIA KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVE NGGLKAKT ITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKR VQK
    • Amino acids248 to 396

Specifications

Our Abpromise guarantee covers the use of ab94032 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 82 µl aqua dest.

General Info

  • Alternative names
    • MGC117401
    • MGC138280
    • MGC142070
    • PCH1
    • PCH1A
    • Serine/threonine protein kinase VRK1
    • Serine/threonine-protein kinase VRK1
    • Vaccinia related kinase 1
    • Vaccinia virus B1R related kinase 1
    • Vaccinia-related kinase 1
    • VRK1
    • VRK1_HUMAN
    see all
  • FunctionSerine/threonine kinase that phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2.
  • Tissue specificityWidely expressed. Highly expressed in fetal liver, testis and thymus.
  • Involvement in diseaseDefects in VRK1 are the cause of pontocerebellar hypoplasia type 1 (PCH1) [MIM:607596]; also called pontocerebellar hypoplasia with infantile spinal muscular atrophy or pontocerebellar hypoplasia with anterior horn cell disease. PCH1 is characterized by an abnormally small cerebellum and brainstem, central and peripheral motor dysfunction from birth, gliosis and anterior horn cell degeneration resembling infantile spinal muscular atrophy (SMA).
  • Sequence similaritiesBelongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. VRK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated at various serine and threonine residues. Autophosphorylation does not impair its ability to phosphorylate p53/TP53.
  • Cellular localizationNucleus. Dispersed throughout the cell but not located on mitotic spindle or chromatids during mitosis.
  • Information by UniProt

Recombinant Human VRK1 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images colored control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human VRK1 protein (ab94032)

ab94032 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab94032.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"