Recombinant Human VSTM2A protein (ab194023)

Overview

  • Product name
    Recombinant Human VSTM2A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SQAKFTEFPRNVTATEGQNVEMSCAFQSGSASVYLEIQWWFLRGPEDLDP GAEGAGAQVKLLPDRDPDSDGTKISTVKVQGNDISHKLQISKVRKKDEGL YECRVTDANYGELQEHKAQAYLKVNANSHARRMQAFEASPMWLQDMKPRK NVSAAIPSSIHGSANQRTHSTSSPQVVAKIPKQSPQSGMETHFEPFILPL TNAPQKGQSYRVDRFMNGDFVDHHHHHH
    • Molecular weight
      26 kDa including tags
    • Amino acids
      24 to 243
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

  • Reconstitution
    Reconstituted protein solution can be stored at 4-7 deg.C for 2-7 days. Aliquots of reconstituted samples are stable at < -20 deg.C for 3 months.

General Info

  • Alternative names
    • MGC33530
    • V set and transmembrane domain containing 2
    • V set and transmembrane domain containing 2A
    • V set and transmembrane domain containing protein 2A
    • VSTM2
    see all
  • Relevance
    VSTM2A contains 1 Ig-like V-type (immunoglobulin-like) domain. The specific function of VSTM2A remains unknown.
  • Cellular localization
    Secreted

References

ab194023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up