Recombinant Human VSTM2L protein (ab116198)

Overview

  • Product name
    Recombinant Human VSTM2L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMTRPAGHAPWDNHVSGHALFTETPHD MTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLK ASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSD GKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQ EACSL
    • Molecular weight
      23 kDa including tags
    • Amino acids
      25 to 204
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab116198 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

General Info

  • Alternative names
    • C20orf102
    • dJ1118M15.2
    • Uncharacterized protein C20orf102 precursor
    • V set and transmembrane domain containing 2 like
    • V set and transmembrane domain containing protein 2 like protein
    • V-set and transmembrane domain-containing protein 2-like protein
    • VSTM 2L
    • Vstm2l
    • VTM2L_HUMAN
    see all
  • Sequence similarities
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116198.

References

ab116198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up