Recombinant Human VSTM2L protein (ab116198)

Overview

  • Product name
    Recombinant Human VSTM2L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMTRPAGHAPWDNHVSGHALFTETPHD MTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLK ASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSD GKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQ EACSL
    • Molecular weight
      23 kDa including tags
    • Amino acids
      25 to 204
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab116198 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

General Info

  • Alternative names
    • C20orf102
    • dJ1118M15.2
    • Uncharacterized protein C20orf102 precursor
    • V set and transmembrane domain containing 2 like
    • V set and transmembrane domain containing protein 2 like protein
    • V-set and transmembrane domain-containing protein 2-like protein
    • VSTM 2L
    • Vstm2l
    • VTM2L_HUMAN
    see all
  • Sequence similarities
    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Information by UniProt

Recombinant Human VSTM2L protein images

  • 15% SDS-PAGE analysis of 3 µg ab116198.

References for Recombinant Human VSTM2L protein (ab116198)

ab116198 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up