Overview

  • Product name
    Recombinant Human WAC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSY SPQENSHNHSALHSSNSHSSNPSNNPSKTSDAPYDSADDWSEHISSSGKK YYYNCRTEVSQWEKPKEWLEREQRQKEANKMAVNSFPKDRDYRREVMQAT ATSGFASGMEDKHSSDASSLLPQNILSQTSRHNDRDYRLPRAETHSSSTP VQHPIKPVVHPTATPSTVPSSPFTLQSDHQPKKSFDANGASTLSKLPTPT SSVPAQKTERKESTSGDKPVSHSCTTPSTSSASGLNPTSAPPTSASAVPV SPVPQSPIPPLLQDPNLLRQLLPALQATLQLNNSNVDISKINEVLTAAVT QASLQSIIHKFLTAGPSAFNITSLISQAAQLSTQAQPSNQSPMSLTSDAS SPRSYVSPRISTPQTNTVPIKPLISTPPVSSQPKVSTPVVKQGPVSQSAT QQPVTADKQQGHEPVSPRSLQRSSSQRSPSPGPNHTSNSSNASNATVVPQ NSSARSTCSLTPALAAHFSENLIKHVQGWPADHAEKQASRLREEAHNMGT IHMSEICTELKNLRSLVRVCEIQATLREQRILFLRQQIKELEKLKNQNSF MV
    • Amino acids
      1 to 602
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162510 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110067P07Rik
    • BA48B24
    • BA48B24.1
    • BM 016
    • FLJ31290
    • KIAA1844
    • MGC10753
    • OTTHUMP00000019380
    • OTTHUMP00000019382
    • PRO1741
    • wac
    • WAC_HUMAN
    • WW domain containing adapter protein with coiled coil
    • WW domain containing adaptor with coiled coil
    • WW domain-containing adapter protein with coiled-coil
    • Wwp4
    see all
  • Function
    Acts as a linker between gene transcription and histone H2B monoubiquitination at 'Lys-120' (H2BK120ub1). Interacts with the RNA polymerase II transcriptional machinery via its WW domain and with RNF20-RNF40 via its coiled coil region, thereby linking and regulating H2BK120ub1 and gene transcription. Regulates the cell-cycle checkpoint activation in response to DNA damage.
  • Sequence similarities
    Contains 1 WW domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues.
  • Cellular localization
    Nucleus speckle. Nucleus. In distinct nuclear speckles. Colocalizes with pre-mRNA processing complexes.
  • Information by UniProt

Images

  • ab162510 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162510 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162510.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up