Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLE TYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM
    • Amino acids
      73 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DICTYOSTELIUM
    • dJ393P12.2
    • IMD2
    • Protein WAVE-2
    • Putative Wiskott Aldrich syndrome protein family member 4
    • SCAR
    • SCAR 2
    • SCAR2
    • Suppressor of cyclic-AMP receptor (WASP family)
    • Verprolin homology domain-containing protein 2
    • WASF2
    • WASF2_HUMAN
    • WASF4
    • WASP family protein member 2
    • WASP family protein member 4
    • WASP family Verprolin homologous protein 2
    • WASP-family protein member 2
    • WAVE 2
    • WAVE2
    • Wiskott-Aldrich syndrome protein family member 2
    • Wiskott-Aldrich syndrome protein family verprolin-homologous protein
    see all
  • Function
    Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex.
  • Tissue specificity
    Expressed in all tissues with strongest expression in placenta, lung, and peripheral blood leukocytes, but not in skeletal muscle.
  • Sequence similarities
    Belongs to the SCAR/WAVE family.
    Contains 1 WH2 domain.
  • Domain
    Binds and activates the Arp2/3 complex via the C-terminal domain. Interacts with actin via the WH2 domain.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection > lamellipodium. At the interface between the lamellipodial actin meshwork and the membrane.
  • Information by UniProt

Images

  • ab160852 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up