Overview

  • Product name
    Recombinant Human WASF3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAED IFGELFNEANNFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKA FKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKKDGLKF YTDPSYFFDLWKEKMLQDTEDKRKEKRRQKREKHKLNPNRNQQVNVRKVR TRKEEWERRKMGIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPAT PNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQ PPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIP SAQTAFVSPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPPGPPPP PPGPPGPGSSLSSSPMHGPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQ LKKVQEQREQEAKREPVGNDVATILSRRIAVEYSDSDDDSEFDENDWSD
    • Amino acids
      1 to 499
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0900
    • Protein WAVE-3
    • Protein WAVE3
    • SCAR3
    • Verprolin homology domain containing protein 3
    • Verprolin homology domain-containing protein 3
    • WASF3
    • WASF3_HUMAN
    • WASP family protein member 3
    • WAVE3
    • Wiskott Aldrich syndrome protein family member 3
    • Wiskott-Aldrich syndrome protein family member 3
    see all
  • Function
    Downstream effector molecules involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton.
  • Tissue specificity
    Expressed in ovary and brain.
  • Sequence similarities
    Belongs to the SCAR/WAVE family.
    Contains 1 WH2 domain.
  • Domain
    Binds the Arp2/3 complex through the C-terminal region and actin through verprolin homology (VPH) domain.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab161165 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up