Overview

  • Product name
    Recombinant Human WDR16 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDNKISPEAQVAELELDAVIGFNGHVPTGLKCHPDQEHMIYPLGCTVLIQ AINTKEQNFLQGHGNNVSCLAISRSGEYIASGQVTFMGFKVDIILWDYKN RELLARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICG SPAAGLNVGNATNVIFSRCRDEMFMTAGNGTIRVWELDLPNRKIWPTESQ TGQLKRIVMSIGVDDDDSFFYLGTTTGDILKMNPRTKLLTDVGPAKDKFS LGVSAIRCLKMGGLLVGSGAGLLVFCKSPGYKPIKKIQLQGGITSITLRG EGHQFLVGTEESHIYRVSFTDFKETLIATCHFDAVKDIVFPFGTAELFAT CAKKDIRVWHTSSNRELLRITVPNMTCHGIDFMRDGKSIISAWNDGKIRA FAPETGRLMYVINNAHRIGVTAIATTSDCKRVISGGGEGEVRVWQIGCQT QKLEEALKEHKSSVSCIRVKRNNEECVTASTDGTCIIWDLVRLRRNQMIL ANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSING MDITQEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSGNITRIRISPGNQ YIVSVSADGAILRWKYPYTS
    • Amino acids
      1 to 620
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CFAP52
    • Cilia and flagella associated protein 52
    • WD repeat containing protein 16
    • WD repeat domain 16
    • WD40 repeat protein up regulated in HCC
    • WD40 repeat protein upregulated in HCC
    • WDRPUH
    see all
  • Relevance
    WD repeat containing proteins, such as WDR16, play crucial roles in a wide range of physiologic functions, including signal transduction, RNA processing, remodeling the cytoskeleton, regulation of vesicular traffic, and cell division. [OMIM]
  • Cellular localization
    Cytoplasm

Images

  • ab165539 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up