Overview

  • Product name
    Recombinant Human WDR36 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLK LHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL
    • Amino acids
      853 to 951
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686I1650
    • GLC 1G
    • GLC1G
    • T cell activation WD repeat containing protein
    • T cell activation WD repeat protein
    • TA WDRP
    • TAWDRP
    • UTP 21
    • UTP21
    • UTP21, S. cerevisiae, homolog of
    • WD repeat containing protein 36
    • WD repeat domain 36
    • WDR 36
    see all
  • Relevance
    WDR36 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. WDR36 is involved in T cell activation and is highly co-regulated with IL2. Mutations in WDR36 are associated with adult-onset primary open-angle glaucoma (POAG).
  • Cellular localization
    Nuclear

Images

  • ab165383 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up