Overview

  • Product name
    Recombinant Human WDR4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISV VPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAA SRIAFWCQENCVALLCDGTSVVYIFQLDARRQQLVYRQQLAFQHQVWDVA FEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAM LEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGP DGHAKKMRPGEATLSC
    • Amino acids
      1 to 266
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • OTTHUMP00000109401
    • OTTHUMP00000109402
    • TRM82
    • tRNA (guanine N(7) ) methyltransferase subunit WDR4
    • tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
    • WD repeat containing protein 4
    • WD repeat protein 4
    • WD repeat protein domain 4 protein isoform 2
    • WD repeat-containing protein 4
    • wdr4
    • WDR4_HUMAN
    see all
  • Function
    Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. In the complex, it is required to stabilize and induce conformational change of the catalytic subunit.
  • Pathway
    tRNA modification; N(7)-methylguanine-tRNA biosynthesis.
  • Sequence similarities
    Belongs to the WD repeat TRM82 family.
    Contains 4 WD repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161153 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up