Recombinant Human WDR42A protein (ab162355)

Overview

  • Product name
    Recombinant Human WDR42A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSL TGDDGGPNRTSTESRGTETESSGEDKDSDSMEDTGHYSINDENRVHDRSE EEEEEEEEEEEEQPRRRVQRKRANRDQDSSDDERALEDWVSSETSALPRP RWQALPALRERELGSSARFVYEACGARVFVQRFRLQHGLEGHTGCVNTLH FNQRGTWLASGSDDLKVVVWDWVRRQPVLDFESGHKSNVFQVRQGSIIAT ERIRHELEKSELQHGLGADSELL
    • Amino acids
      1 to 273
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCAF8
    • DDB1 and CUL4 associated factor 8
    • DKFZp781G1096
    • FLJ35857
    • H326
    • MGC117276
    • MGC118891
    • MGC99640
    • WD repeat containing protein 42A
    • WD repeat domain 42A
    • WDR 42A
    see all
  • Relevance
    This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. The protein contains 7 WD repeats. There are two isoforms produced by alternative splicing.

Images

  • ab162355 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up