Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61964
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMATEEKKPETEAARAQPTPSSSATQSKPTP VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFE KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSN YVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYIL AATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW KSDC
    • Molecular weight39 kDa including tags
    • Amino acids1 to 334
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab98079 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 2410008O07Rik
    • AA408785
    • AA960360
    • Big
    • BIG 3
    • BIG3
    • BMP2 induced 3 kb gene protein
    • BMP2 induced gene, 3-KB
    • BMP2-induced 3-kb gene protein
    • MGC114572
    • OTTHUMP00000162494
    • SWD 3
    • SWD3
    • SWD3 Set1c WD40 repeat protein homolog
    • WD repeat containing protein 5
    • WD repeat domain 5
    • WD repeat protein 5
    • WD repeat-containing protein 5
    • WD repeat-containing protein BIG-3
    • WDR 5
    • Wdr5
    • WDR5_HUMAN
    see all
  • FunctionContributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation.
  • Sequence similaritiesBelongs to the WD repeat WDR5/wds family.
    Contains 7 WD repeats.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human WDR5 protein images

  • 15% SDS-PAGE analysis of 3µg ab98079

References for Recombinant Human WDR5 protein (ab98079)

ab98079 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"