Overview

  • Product name
    Recombinant Human WDR73 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDPGDDWLVESLRLYQDFYAFDLSGATRVLEWIDDKGVFVAGYESLKKNE ILHLKLPLRLSVKENKGLFPERDFKVRHGGFSDRSIFDLKHVPHTRLLVT SGLPGCYLQVWQVAEDSDVIKAVSTIAVHEKEESLWPRVAVFSTLAPGVL HGARLRSLQVVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRL GLVDTRQKWAPLENRSPGPGSGGERWCAEVGSWGQGPGPSIASLGSDGRL CLLDPRDLCHPVSSVQCPVSVPSPDPELLRVTWAPGLKNCLAISGFDGTV QVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWH PCRPRTLLSATNDASLHVWDWVDLCAPR
    • Amino acids
      1 to 378
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1200011I23Rik
    • 2410008B13Rik
    • AI848574
    • C85352
    • FLJ00296 protein
    • FLJ14888
    • HSPC264
    • Neuromedin B
    • Nmb
    • OTTMUSP00000029485
    • OTTMUSP00000029486
    • WD repeat containing protein 73
    • WD repeat domain 73
    • WDR 73
    see all
  • Relevance
    WDR73 belongs to the WD repeat WDR73 family and contains 3 WD repeats.

Images

  • ab164705 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up