Overview

  • Product name
    Recombinant Human WDR82 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPSLPTTNCVHSLQMIPPLSPAPNQELVLGLCYMSYLAFLYMTFDFCCLY FSTVYAPSFKYICVHTDTHICVCVCIYLSSVVSKSSAEADGVLQPRRHPA SLLIVFATSISESSLLIFSFQKTEAKLIVFAVSLAAK
    • Amino acids
      1 to 137
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • TMEM113
    • MST107
    • MSTP107
    • PRO2730
    • PRO34047
    • Protein TMEM113
    • Swd2
    • transmembrane protein 113
    • UNQ9342/PRO34047
    • WD repeat domain 82
    • WD repeat-containing protein 82
    • wdr82
    • WDR82_HUMAN
    • WDR82A
    see all
  • Function
    Regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
  • Sequence similarities
    Belongs to the WD repeat SWD2 family.
    Contains 6 WD repeats.
  • Cellular localization
    Nucleus. Associates with chromatin.
  • Information by UniProt

Images

  • ab164261 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up