Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK RLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRV TSLLGAGRQSLLRTAKGTLI
    • Amino acids
      1 to 120
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bromodomain and WD repeat domain containing protein 1
    • Bromodomain and WD repeat-containing protein 1
    • Brwd1
    • BRWD1_HUMAN
    • C21orf107
    • cAMP response element binding and beta tranducin family
    • FLJ11315
    • N143
    • Transcriptional unit N143
    • WD repeat protein
    • WD repeat-containing protein 9
    • WDR9
    see all
  • Function
    May be a transcriptional activator. May be involved in chromatin remodeling.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Contains 2 bromo domains.
    Contains 8 WD repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab162713 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up