Recombinant Human WFDC12 protein (ab165301)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCH TDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKC PGSSSTRCPQK
    • Amino acids
      1 to 111
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C20orf122
    • dJ211D12.4
    • Protease inhibitor WAP2
    • Putative protease inhibitor WAP12
    • Single WAP motif protein 2
    • SWAM2
    • WAP four disulfide core domain 12
    • WAP four-disulfide core domain protein 12
    • WAP2
    • WFD12_HUMAN
    • WFDC12
    • Whey acidic protein 2
    see all
  • Function
    Antibacterial protein. Putative acid-stable proteinase inhibitor.
  • Tissue specificity
    Highly expressed in prostate, skin, lung and esophagus. Weakly expressed in skeletal muscle, epididymis, kidney, trachea, salivary gland, testis and seminal vesicle.
  • Sequence similarities
    Contains 1 WAP domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab165301 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up