Recombinant Human WFDC12 protein (ab177599)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSVKEGIEKAGVCPADNVRCFKSDPPQCH TDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKC PGSSSTRCPQK
    • Molecular weight
      12 kDa including tags
    • Amino acids
      24 to 111
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_543145

Specifications

Our Abpromise guarantee covers the use of ab177599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab177599 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • C20orf122
    • dJ211D12.4
    • Protease inhibitor WAP2
    • Putative protease inhibitor WAP12
    • Single WAP motif protein 2
    • SWAM2
    • WAP four disulfide core domain 12
    • WAP four-disulfide core domain protein 12
    • WAP2
    • WFD12_HUMAN
    • WFDC12
    • Whey acidic protein 2
    see all
  • Function
    Antibacterial protein. Putative acid-stable proteinase inhibitor.
  • Tissue specificity
    Highly expressed in prostate, skin, lung and esophagus. Weakly expressed in skeletal muscle, epididymis, kidney, trachea, salivary gland, testis and seminal vesicle.
  • Sequence similarities
    Contains 1 WAP domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab177599.

References

ab177599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up