Recombinant Human WFIKKN2 protein (ab165224)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWAPRCRRFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDM NPNLWVDAQSTCRRECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKK GPVGMPKEATCDHFMCLQQGSECDIWDGQPVCKCKDRCEKEPSFTCASDG LTYYNRCYMDAEACSKGITLAVVTCRYHFTWPNTSPPPPETTMHPTTASP ETPELDMAAPALLNNPVHQSVTMGETVSFLCDVVGRPRPEITWEKQLEDR ENVVMRPNHVRGNVVVTNIAQLVIYNAQLQDAGIYTCTARNVAGVLRADF PLSVVRGHQAAATSESSPNGTAFPAAECLKPPDSEDCGEEQTRWHFDAQA NNCLTFTFGHCHRNLNHFETYEACMLACMSGPLAACSLPALQGPCKAYAP RWAYNSQTGQCQSFVYGGCEGNGNNFESREACEESCPFPRGNQRCRACKP RQKLVTSFCRSDFVILGRVSELTEEPDSGRALVTVDEVLKDEKMGLKFLG QEPLEVTLLHVDWACPCPNVTVSEMPLIIMGEVDGGMAMLRPDSFVGASS ARRVRKLREVMHKKTCDVLKEFLGLH
    • Amino acids
      1 to 576
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • follistatin
    • GASP 1
    • GASP-1
    • Growth and differentiation factor-associated serum protein 1
    • hGASP 1
    • hGASP-1
    • immunoglobulin
    • kazal
    • kunitz and NTR domain-containing protein 2
    • kunitz and NTR domain-containing-related protein
    • UNQ9235/PRO31996
    • WAP
    • WAP follistatin immunoglobulin kunitz and NTR domain containing-related protein
    • WAP kazal immunoglobulin kunitz and NTR domain containing protein 2
    • WFIKKN-related protein
    • Wfikkn2
    • WFKN2_HUMAN
    see all
  • Function
    Protease-inhibitor that contains multiple distinct protease inhibitor domains. Probably has serine protease- and metalloprotease-inhibitor activity. Inhibits the biological activity of mature myostatin, but not activin.
  • Tissue specificity
    Primarily expressed in ovary, testis and brain, but not in liver. In fetal tissues, it is primarily expressed in brain, skeletal muscle, thymus and kidney.
  • Sequence similarities
    Belongs to the WFIKKN family.
    Contains 2 BPTI/Kunitz inhibitor domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Kazal-like domain.
    Contains 1 NTR domain.
    Contains 1 WAP domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab165224 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up