Recombinant Human WHSC1/NSD2 protein (ab159810)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSK AQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRF ESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAAD VSQSEENGQKPENKARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKI PAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYT KLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVG DQLHLNPQVAKEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRR RRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRA RYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAEAEDTPRKRLR TDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKR NRASTAASSALGFSKSSSPSASLTENELLWEPTPVKLDLNPAALYCT
    • Amino acids
      1 to 647
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ23286
    • IL5 promoter REII region binding protein
    • KIAA1090
    • MGC176638
    • MMSET
    • MMSET type II
    • Multiple myeloma SET domain containing protein type III
    • Multiple myeloma SET domain protein
    • Multiple myeloma SET domain-containing protein
    • NSD 2
    • NSD2
    • NSD2_HUMAN
    • Nuclear receptor binding SET domain protein 2
    • Nuclear SET domain-containing protein 2
    • Probable histone-lysine N-methyltransferase NSD2
    • Protein trithorax-5
    • REIIBP
    • Trithorax/ash1 related protein 5
    • TRX5
    • TRX5 protein
    • WHS
    • Whsc1
    • Wolf Hirschhorn syndrome candidate 1
    • Wolf Hirschhorn syndrome candidate 1 protein
    • Wolf-Hirschhorn syndrome candidate 1 protein
    see all
  • Function
    Probable histone methyltransferase (By similarity). May act as a transcription regulator that binds DNA and suppresses IL5 transcription.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Note=A chromosomal aberration involving WHSC1 is a cause of multiple myeloma tumors. Translocation t(4;14)(p16.3;q32.3) with IgH.
    Note=WHSC1 is located in the Wolf-Hirschhorn syndrome (WHS) critical region. WHS results from by sub-telomeric deletions in the short arm of chromosome 4. WHSC1 is deleted in every case, however deletion of linked genes contributes to both the severity of the core characteristics and the presence of the additional syndromic problems.
  • Sequence similarities
    Belongs to the histone-lysine methyltransferase family. SET2 subfamily.
    Contains 1 AWS domain.
    Contains 1 HMG box DNA-binding domain.
    Contains 4 PHD-type zinc fingers.
    Contains 1 post-SET domain.
    Contains 2 PWWP domains.
    Contains 1 SET domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm and Nucleus. Chromosome.
  • Information by UniProt

Images

  • ab159810 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up