Recombinant human WHSC1/NSD2 protein (Catalytic domain) (ab198120)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEGDRGSRYQGVRGIGRVFK NALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD ISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTK RQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHA HENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDT RVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTS TTLSSEEKGKKTKKKTRRRRAKGEGKRQSED
    • Molecular weight
      62 kDa including tags
    • Amino acids
      941 to 1240
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      GenBank Accession No. NM_133330

Specifications

Our Abpromise guarantee covers the use of ab198120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 0.036 pmol/min/μg

    Assay Conditions: Add 50 μL reaction mix (100 μM S-adenosylmethionine, and 50-250 ng WHSC1/NSD2 in HMT buffer 7) to wells coated with the substrate. Incubate at 37oC for 2 hours. Add antibody against methylated K36 residue of histone H3, incubate 1 hour. Then, add secondary HRP-labeled antibody and incubate 30 minutes. Finally, add HRP chemiluminescent substrates and read luminescence.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >= 82 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    pH: 8.5
    Constituents: 0.79% Tris HCl, 1.74% Sodium chloride, 0.08% DTT, 0.31% Glutathione, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • FLJ23286
    • IL5 promoter REII region binding protein
    • KIAA1090
    • MGC176638
    • MMSET
    • MMSET type II
    • Multiple myeloma SET domain containing protein type III
    • Multiple myeloma SET domain protein
    • Multiple myeloma SET domain-containing protein
    • NSD 2
    • NSD2
    • NSD2_HUMAN
    • Nuclear receptor binding SET domain protein 2
    • Nuclear SET domain-containing protein 2
    • Probable histone-lysine N-methyltransferase NSD2
    • Protein trithorax-5
    • REIIBP
    • Trithorax/ash1 related protein 5
    • TRX5
    • TRX5 protein
    • WHS
    • Whsc1
    • Wolf Hirschhorn syndrome candidate 1
    • Wolf Hirschhorn syndrome candidate 1 protein
    • Wolf-Hirschhorn syndrome candidate 1 protein
    see all
  • Function
    Probable histone methyltransferase (By similarity). May act as a transcription regulator that binds DNA and suppresses IL5 transcription.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Note=A chromosomal aberration involving WHSC1 is a cause of multiple myeloma tumors. Translocation t(4;14)(p16.3;q32.3) with IgH.
    Note=WHSC1 is located in the Wolf-Hirschhorn syndrome (WHS) critical region. WHS results from by sub-telomeric deletions in the short arm of chromosome 4. WHSC1 is deleted in every case, however deletion of linked genes contributes to both the severity of the core characteristics and the presence of the additional syndromic problems.
  • Sequence similarities
    Belongs to the histone-lysine methyltransferase family. SET2 subfamily.
    Contains 1 AWS domain.
    Contains 1 HMG box DNA-binding domain.
    Contains 4 PHD-type zinc fingers.
    Contains 1 post-SET domain.
    Contains 2 PWWP domains.
    Contains 1 SET domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm and Nucleus. Chromosome.
  • Information by UniProt

Images

  • Specific activity of ab198120 was determined to be 0.036 pmol/min/μg.

  • 4-20% SDS-PAGE stained with Coomassie Blue.
    Lane 1: ab198120 (2 µg)
    Lane 2: Protein Marker

References

ab198120 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198120.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up