Overview

  • Product name
    Recombinant Human WHSC2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPGQRRALSPKMASMRESDTGLWLHNKLGA TDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGTLHLPRRTVD EMKGALMEIIQLASLDSDPWVLMVADILKSFPDTGSLNLELEEQNPNVQD ILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKP KSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMDTTTPLKGIPK QAPFRSPTAPSVFSPTGNRTPIPPSRTLLRKERGVKLLDISELDMVGAGR EAKRRRKTLDAEVVEKPAKEETVVENATPDYAAGLVSTQKLGSLNNEPAL PSTSYLPSTPSVVPASSYIPSSETPPAPSSREASRPPEEPSAPSPTLPAQ FKQRAPMYNSGLSPATPTPAAPTSPLTPTTPPAVAPTTQTPPVAMVAPQT QAPAQQQPKKNLSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSREN PCQEQGDVIQIKLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQWTRFK KYKPMTNVS
    • Molecular weight
      61 kDa including tags
    • Amino acids
      1 to 539
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116197 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab116197 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 1.17% Sodium chloride, 0.08% DTT, 0.03% EDTA, 20% Glycerol

General Info

  • Alternative names
    • FLJ10442
    • FLJ25112
    • Negative elongation factor A
    • Negative elongation factor polypeptide A
    • NELF A
    • NELF-A
    • NELFA
    • NELFA_HUMAN
    • P/OKcl.15
    • P/OKcl15
    • WHSC 2
    • Whsc2
    • Wolf Hirschhorn syndrome candidate 2
    • Wolf Hirschhorn syndrome candidate 2 protein
    • Wolf-Hirschhorn syndrome candidate 2 protein
    see all
  • Function
    Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. Probably required to interact with the RNA polymerase II complex.
  • Tissue specificity
    Ubiquitous. Expressed in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas. Expressed at lower level in adult lung. Expressed in fetal brain, lung, liver and kidney.
  • Sequence similarities
    Belongs to the NELF-A family.
    Contains 1 HDAg-like domain.
  • Domain
    The HDAg-like domain is essential for transcriptional repression, and mediates the interaction with the RNA polymerase II complex.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116197.

References

ab116197 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116197.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up