Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVP GYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQ
    • Amino acids
      348 to 445
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATG 18
    • ATG18
    • Atg18 protein homolog
    • ATG18A
    • FLJ10055
    • WD repeat domain phosphoinositide interacting 1
    • WD repeat domain phosphoinositide interacting protein 1
    • WD repeat domain phosphoinositide-interacting protein 1
    • WD40 repeat protein interacting with phosphoinositides of 49 kDa
    • WD40 repeat protein interacting with phosphoInositides of 49kDa
    • WIPI 1
    • WIPI 1 alpha
    • WIPI 49
    • WIPI 49 kDa
    • WIPI-1
    • wipi1
    • WIPI1_HUMAN
    • WIPI49
    see all
  • Function
    May play a role in autophagy. May regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway.
  • Tissue specificity
    Ubiquitously expressed. Highly expressed in skeletal muscle, heart, testis, pancreas and placenta. Highly expressed in G361, Sk-mel-28, Sk-mel-13, WM852 and WM451 cells. Up-regulated in a variety of tumor tissues.
  • Sequence similarities
    Belongs to the WD repeat SVP1 family.
    Contains 3 WD repeats.
  • Cellular localization
    Golgi apparatus > trans-Golgi network. Endosome. Cytoplasmic vesicle > clathrin-coated vesicle. Trans elements of the Golgi and peripheral endosomes. Dynamically cycles through these compartments and is susceptible to conditions that modulate membrane flux. Enriched in clathrin-coated vesicles.
  • Information by UniProt

Images

  • ab162949 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162949 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up