Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYELLVLFMLIQPQSMAHPCGGTPTYPESQIFFPTIHERPVSFSPPPTCP PKVAISQRRKSTSFLEAQTHHFQPLLRTVGQSLLPPGGSPTNWTPEAVVM LGTTASRVTGESCEIQVHPMFEPSQVYSDYRPGLVLPEEAHYFIPQEAVY VAGVHYQARVAEQYEGIPYNSSVLSSPMKQIPEQKPVQGGPTSSSVFEFP SGQAFLVGHLQNLRLDSGLGPGSPLSSISAPISTDATRLKFHPVFVPHSA PAVLTHNNESRSNCVFEFHVHTPSSSSGEGGGILPQRVYRNRQVAVDLNQ EELPPQSVGLHGYLQPVTEEKHNYHAPELTVSVVEPIGQNWPIGSPEYSS DSSQITSSDPSDFQSPPPTGGAAAPFGSDVSMPFIHLPQTVLQESPLFFC FPQGTTSQQVLTASFSSGGSALHPQVIGKLPQLF
    • Amino acids
      1 to 434
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166391 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Erythrocyte 65 kDa protein
    • HSAN2
    • HSN2
    • hWNK1
    • KDP
    • KIAA0344
    • Kinase deficient protein
    • MGC163339
    • MGC163341
    • p65
    • PPP1R167
    • PRKWNK1
    • Prostate derived sterile 20 like kinase
    • Protein kinase lysine deficient 1
    • Protein kinase lysine-deficient 1
    • Protein kinase with no lysine 1
    • Protein phosphatase 1, regulatory subunit 167
    • PSK
    • Serine/threonine protein kinase WNK1
    • Serine/threonine protein kinase WNK1 1
    • Serine/threonine protein kinase WNK1 2
    • Serine/threonine-protein kinase WNK1
    • With no K
    • WNK lysine deficient protein kinase 1
    • WNK lysine deficient protein kinase 1 isoform
    • WNK1
    • WNK1_HUMAN
    see all
  • Function
    Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4, SLC26A6 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition.
  • Tissue specificity
    Widely expressed, with highest levels observed in the testis, heart, kidney and skeletal muscle. Isoform 3 is kidney-specific and specifically expressed in the distal convoluted tubule (DCT) and connecting tubule (CNT) of the nephron.
  • Involvement in disease
    Pseudohypoaldosteronism 2C
    Neuropathy, hereditary sensory and autonomic, 2A
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    O-glycosylated.
    Ubiquitinated in vitro by the BCR(KLHL3) complex and in vivo by a BCR(KLHL2) complex, leading to proteasomal degradation.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab166391 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166391 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166391.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up