Overview

  • Product name
    Recombinant Human WNK3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATDSGDPASTEDSEKPDGISFENRVPQVAATLTVEARLKEKNSTFSASG ETVERKRFFRKSVEMTEDDKVAESSPKDERIKAAMNIPRVDKLPSNVLRG
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1566
    • PRKWNK 3
    • PRKWNK3
    • Protein kinase lysine deficient 3
    • Protein kinase lysine-deficient 3
    • Protein kinase with no lysine 3
    • Serine/threonine protein kinase WNK3
    • Serine/threonine-protein kinase WNK3
    • WNK 3
    • WNK lysine deficient protein kinase 3
    • Wnk3
    • WNK3_HUMAN
    see all
  • Tissue specificity
    Expressed in brain, lung, kidney, liver and pancreas, and in fetal tissues including placenta, fetal brain, lung and kidney. Very low levels of expression were also detected in fetal heart, thymus, liver and spleen.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab163933 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up