Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGS FPTSRRNSLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
    • Amino acids
      1144 to 1243
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163932 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PHA 2B
    • PHA2B
    • PRKWNK 4
    • PRKWNK4
    • Protein kinase lysine deficient 4
    • Protein kinase lysine-deficient 4
    • Protein kinase with no lysine 4
    • Serine/threonine protein kinase WNK4
    • Serine/threonine-protein kinase WNK4
    • WNK lysine deficient protein kinase 4
    • Wnk4
    • WNK4_HUMAN
    see all
  • Function
    Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D, SGK1, TRPV5 and TRPV6. Regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation which appears to prevent membrane trafficking of SLC12A3. Also inhibits the renal K(+) channel, KCNJ1, via a kinase-independent mechanism by which it induces clearance of the protein from the cell surface by clathrin-dependent endocytosis. WNK4 appears to act as a molecular switch that can vary the balance between NaCl reabsorption and K(+) secretion to maintain integrated homeostasis. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition.
  • Tissue specificity
    Expressed in kidney, colon and skin.
  • Involvement in disease
    Pseudohypoaldosteronism 2B
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated by WNK1 and WNK3.
    Ubiquitinated by the BCR(KLHL3) complex, leading to its degradation and increased expression of KCNJ1 at the cell surface. Ubiquitinated by the BCR(KLHL2) complex.
  • Cellular localization
    Cell junction, tight junction. Present exclusively in intercellular junctions in the distal convoluted tubule and in both the cytoplasm and intercellular junctions in the cortical collecting duct. WNK4 is part of the tight junction complex (By similarity).
  • Information by UniProt

Images

  • ab163932 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163932 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163932.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up