Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSS QRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRV LLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKMGSAKDSKG IFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKR FLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDG TGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKA PKNADWTTAT
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 360

Specifications

Our Abpromise guarantee covers the use of ab152803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Int 1 related protein
    • Int-1-like protein 1
    • Int-1-related protein
    • INT1L 1
    • INT1L1
    • IRP
    • IRP protein
    • ONCOGENE INT1 LIKE 1
    • Protein Wnt-2
    • Secreted growth factor
    • Wingless type MMTV integration site family member 2
    • WNT 2
    • WNT2
    • WNT2_HUMAN
    see all
  • Function
    Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.
  • Tissue specificity
    Expressed in brain in the thalamus, in fetal and adult lung and in placenta.
  • Sequence similarities
    Belongs to the Wnt family.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152803 stained with Coomassie Blue.

References

ab152803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up