Overview

  • Product name
    Recombinant Human Wnt6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGR QAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQ DIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPG TPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRA LVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARL LERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVV QCHRCRVRKELSLCL
    • Amino acids
      1 to 365
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159813 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Protein Wnt 6
    • Protein Wnt-6
    • Protein Wnt-6 precursor
    • Wingless type MMTV integration site family, member 6
    • wnt 6
    • Wnt6
    • WNT6_HUMAN
    see all
  • Function
    Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters.
  • Sequence similarities
    Belongs to the Wnt family.
  • Post-translational
    modifications
    Palmitoylation at Ser-228 is required for efficient binding to frizzled receptors. It is also required for subsequent palmitoylation at Cys-76. Palmitoylation is necessary for proper trafficking to cell surface.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab159813 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159813 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159813.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up