Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MHHHHHHKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYY DVITHPM DFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHV LSCMVKTEQCLVALL HKHLPGHPYV
    • Molecular weight
      15 kDa including tags
    • Amino acids
      1335 to 1450
    • Tags
      His tag N-Terminus
    • Additional sequence information
      GenBank Accession No. NM_032408

Specifications

Our Abpromise guarantee covers the use of ab196102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 20% Glycerol, 0.02% Potassium chloride, 0.63% Tris HCl, 0.64% Sodium chloride

General Info

  • Alternative names
    • baz1b
    • BAZ1B_HUMAN
    • Bromodomain adjacent to zinc finger domain protein 1B
    • hWALP 2
    • hWALP-2
    • hWALP2
    • transcription factor WSTF
    • Tyrosine-protein kinase BAZ1B
    • WALP-2
    • WALP2
    • WBRS 9
    • WBRS-9
    • WBRS9
    • WBSC 10
    • WBSC-10
    • WBSC10
    • WBSCR10
    • WBSCR9
    • Williams Beuren syndrome chromosome region 9 protein
    • Williams syndrome transcription factor
    • Williams-Beuren syndrome chromosomal region 10 protein
    • Williams-Beuren syndrome chromosomal region 9 protein
    • WSTF
    see all
  • Function
    Atypical tyrosine-protein kinase that plays a central role in chromatin remodeling and acts as a transcription regulator. Involved in DNA damage response by phosphorylating 'Tyr-142' of histone H2AX (H2AXY142ph). H2AXY142ph plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Essential component of the WICH complex, a chromatin remodeling complex that mobilizes nucleosomes and reconfigures irregular chromatin to a regular nucleosomal array structure. The WICH complex regulates the transcription of various genes, has a role in RNA polymerase I and RNA polymerase III transcription, mediates the histone H2AX phosphorylation at 'Tyr-142', and is involved in the maintenance of chromatin structures during DNA replication processes. In the complex, it mediates the recruitment of the WICH complex to replication foci during DNA replication. Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. In the WINAC complex, plays an essential role by targeting the complex to acetylated histones, an essential step for VDR-promoter association.
  • Tissue specificity
    Ubiquitously expressed with high levels of expression in heart, brain, placenta, skeletal muscle and ovary.
  • Involvement in disease
    Note=BAZ1B is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of BAZ1B may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similarities
    Belongs to the WAL family. BAZ1B subfamily.
    Contains 1 bromo domain.
    Contains 1 DDT domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 WAC domain.
  • Developmental stage
    Expressed at equal levels in 19-23 weeks old fetal tissues.
  • Domain
    The N-terminal part (1-345), including the WAC domain and the C motif, mediates the tyrosine-protein kinase activity.
    The bromo domain mediates the specific interaction with acetylated histones.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Accumulates in pericentromeric heterochromatin during replication. Targeted to replication foci throughout S phase via its association with PCNA.
  • Information by UniProt

Images

  • 4-20% SDS Page analysis of ab196102 (2 μg)

References

ab196102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up