Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQ KREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFK MPEAGEGKSQV
    • Amino acids
      1 to 111
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160518 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 12.2
    • Cancer/testis antigen family 12, member 2
    • CT12.2
    • G antigen family D 3
    • G antigen family D member 3
    • GAGED3
    • Protein XAGE 2
    • Protein XAGE2
    • X antigen family member 2
    • X antigen family, member 2
    • X antigen family, member 2B
    • XAGE 2
    • XAGE 2 protein
    • XAGE2B
    see all
  • Relevance
    XAGE2 belongs to the GAGE family of genes which are expressed in a variety of tumors and in some fetal and reproductive tissues. XAGE2 is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. Its function is unknown.

Images

  • ab160518 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160518 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160518.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up