Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UPY5
    • SpeciesHuman
    • SequenceMVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGV SIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAEL GTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYI LEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLT AILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWF YLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLS NAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGH LPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFI GLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFST GIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDK L
    • Molecular weight81 kDa including tags
    • Amino acids1 to 501

Specifications

Our Abpromise guarantee covers the use of ab112403 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

    Other

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Amino acid transport system xc xCT antibody
    • Amino acid transport system xc-
    • Calcium channel blocker resistance protein CCBR1
    • Calcium channel blocker resistance protein CCBR1 antibody
    • CCBR1
    • Cysteine/glutamate transporter antibody
    • Cystine/glutamate transporter
    • OTTHUMP00000164578
    • SLC7A11
    • solute carrier family 7
    • Solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11
    • Solute carrier family 7 member 11
    • Solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
    • SYSTEM Xc(-) TRANSPORTER-RELATED PROTEIN
    • xCT
    • XCT_HUMAN
    see all
  • FunctionSodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.
  • Sequence similaritiesBelongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human xCT protein images

  • 12.5% SDS-PAGE analysis of ab112403. Stained with Coomassie Blue

References for Recombinant Human xCT protein (ab112403)

ab112403 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112403.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"