Overview

  • Product name
    Recombinant Human XPO6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PGQVFKPFLPSIIALCMEQVYPIIAERPSPDVKAELFELLFRTLHHNWRY FFKSTVLASVQRGIAEEQMENEPQFSAIMQAFGQSFLQPDIHLFKQNLFY LETLNTKQ
    • Amino acids
      903 to 1010
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Exp6
    • Exportin 6
    • Exportin-6
    • RAN binding protein 20
    • Ran-binding protein 20
    • RANBP20
    • xpo6
    • XPO6_HUMAN
    see all
  • Function
    Mediates the nuclear export of actin and profilin-actin complexes in somatic cells.
  • Sequence similarities
    Belongs to the exportin family.
    Contains 1 importin N-terminal domain.
  • Cellular localization
    Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • ab161573 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161573 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up