Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMD QDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEAN
    • Amino acids
      598 to 695
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160384 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ90308
    • OTTHUMP00000033084
    • OTTHUMP00000033085
    • Polytropic murine leukamia virus receptor SYG 1
    • Polytropic murine leukamia virus receptor SYG1
    • Protein SYG1 homolog
    • SYG 1
    • SYG1
    • SYG1 protein
    • X-receptor
    • X3
    • Xenotropic and polytropic murine leukemia virus receptor X3
    • Xenotropic and polytropic retrovirus receptor
    • Xenotropic and polytropic retrovirus receptor 1
    • XPR 1
    • XPR1
    • XPR1 protein
    • XPR1_HUMAN
    see all
  • Function
    May function in G-protein coupled signal transduction (By similarity). Potential receptor for xenotropic and polytropic murine leukemia retroviruses.
  • Tissue specificity
    Widely expressed. Detected in spleen, lymph node, thymus, leukocytes, bone marrow, heart, kidney, pancreas and skeletal muscle.
  • Sequence similarities
    Belongs to the SYG1 (TC 2.A.94) family.
    Contains 1 EXS domain.
    Contains 1 SPX domain.
  • Developmental stage
    Expressed in fetal liver.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab160384 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160384 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160384.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up