Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPE GTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRL SQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDS LSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQ KASSSSEEPSHASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSS NQFSLVSRCLKSNSLKKHFFIIGESGVEFC
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 280
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp781P0919
    • DNA repair protein XRCC2
    • X ray repair complementing defective repair in Chinese hamster cells 2
    • X ray repair cross complementing protein 2
    • X-ray repair cross-complementing protein 2
    • Xrcc2
    • XRCC2_HUMAN
    see all
  • Function
    Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA.
  • Sequence similarities
    Belongs to the RecA family. RAD51 subfamily.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm, Cytoskeleton, Nucleus
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152808 stained with Coomassie Blue.

References

ab152808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up