Recombinant Human XRCC6BP1 protein (ab164855)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVA KKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI
    • Amino acids
      152 to 246
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.4.24
    • Ku70 binding protein 3
    • KUB3
    • MGC134817
    • MGC134818
    • Mitochondrial inner membrane protease ATP23 homolog
    • XRCC6 binding protein 1
    see all
  • Relevance
    XRCC6BP1 may be involved in double-strand break repair via nonhomologous end joining.

Images

  • ab164855 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up