Overview

  • Product name
    Recombinant Human YIPF3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATTAAPAGGARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDM GELHQRLREEEVDADAADAAAAEEEDGEFLGMKGFKGQLSRQVADQMWQA GKRQASRAFSLYANIDILRPYFDVEPAQVRSRLLESMIPIKMVNFPQKIA GELYGPLMLVFTLVAILLHGMKTSDTIIREGTLMGTAIGTCFGYWLGVSS FIYFLAYLCNAQITMLQMLALLGYGLFGHCIVLFITYNIHLHALFYLFWL LVGGLSTLRMVAVLVSRTVGPTQRLLLCGTLAALHMLFLLYLHFAYHKVV EGILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH
    • Amino acids
      1 to 350
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf109
    • dJ337H4.3
    • FinGER3
    • Killer lineage protein 1
    • KLIP1
    • Natural killer cell-specific antigen KLIP1
    • Protein YIPF3
    • Yip1 domain family member 3
    • YIP1 family member 3
    • Yipf3
    • YIPF3_HUMAN
    see all
  • Function
    May play a role in hematopoiesis.
  • Tissue specificity
    Expressed by nucleated hematopoietic cells (at protein level).
  • Sequence similarities
    Belongs to the YIP1 family.
  • Developmental stage
    Expressed in fetal liver (at protein level). Expressed in embryonic hematopoiesis sites.
  • Post-translational
    modifications
    Not glycosylated.
  • Cellular localization
    Cell membrane. Cytoplasm. Localization to the cytoplasm or to the cell membrane is developmentally and ontogenetically regulated.
  • Information by UniProt

Images

  • ab161810 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up